PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G297200.1.p
Common NamePRUPE_ppa003619mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bHLH
Protein Properties Length: 564aa    MW: 60358 Da    PI: 4.9998
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G297200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH261.7e-08377427355
                         HHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                 HLH   3 rahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                          +h+ +Er RR++i +++  L++l+P +   +     Ka +L + ++Y++sLq
  Prupe.1G297200.1.p 377 NSHSLAERVRREKISERMKFLQDLVPGC--SKVVVTGKAVMLDEIINYVQSLQ 427
                         58*************************8..26666*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000831.57E-10372431No hitNo description
SuperFamilySSF474593.93E-16372445IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088815.237374426IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.4E-5377427IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.105.2E-15378443IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.7E-10380432IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MDMGDQDKFE LENRNEDPMN YSPGMAPDWR FGGSNLTNTS VGLVSTGNSM AVSKGDLVGS  60
SSRPSASMVD SFNPTLWDHP TNSQDLGGFC DINGQTSAST SDTIGIRKGI PVSLRSGIDR  120
PLEMCWNPPN SMLKGGIFLP NGPGMLPQSL SQFPADSAFI ERAARFSCFN GGSFSDMLNP  180
FGVPESMSLY SRGGGMMHWT QEVVAGNGSN AVSCAQSQRN EINGGDASRD VTLPIELGTT  240
EGSPLKNEKK SESLVKSHDE AKHTVGGSGN ESDEADFSGG AGQEEPSMLE GTGVEPSSKG  300
SKKRKRSGQA NELDQAHAQQ PGESAQDASE FQQKGEQHPA STTNKTTGKQ SKQGSQASDP  360
PKEEYIHVRA RRGQATNSHS LAERVRREKI SERMKFLQDL VPGCSKVVVT GKAVMLDEII  420
NYVQSLQRQV EFLSMKLATV NPRLDFNIEG LLTKDILQSR VGPSSTLGFS PDMPIAYPQL  480
HPSQSGLIQA DLPGMGSPSD ILRRAMSSQM TPMTGGFKEP SQLPNVWEDE LHNVVQMSYG  540
ASTPTGSQDV DGSGTPGQMK VEL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1301306KKRKRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007225728.10.0hypothetical protein PRUPE_ppa003619mg
TrEMBLM5XLG40.0M5XLG4_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s14600.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72493248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68920.21e-133bHLH family protein